Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

TDP1

DescriptionTyrosyl-DNA phosphodiesterase 1

Gene and Protein Information

Gene ID55775
Uniprot Accession IDs Q2HXX4 Q86TV8 Q96BK7 Q9NZM7 Q9NZM8 Tyr-DNA phosphodiesterase 1
Ensembl ID ENSP00000337353
FamilyBelongs to the tyrosyl-DNA phosphodiesterase family.
Sequence
MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453096TDP1tyrosyl-DNA phosphodiesterase 19598VGNC:6768Inparanoid, OMA, EggNOG
Macaque695338TDP1tyrosyl-DNA phosphodiesterase 19544Inparanoid, OMA, EggNOG
Mouse104884Tdp1tyrosyl-DNA phosphodiesterase 110090MGI:1920036Inparanoid, OMA, EggNOG
Rat314380Tdp1tyrosyl-DNA phosphodiesterase 110116RGD:1309618Inparanoid, OMA, EggNOG
Dog490828TDP1tyrosyl-DNA phosphodiesterase 19615VGNC:47218Inparanoid, OMA, EggNOG
Horse100062463TDP1tyrosyl-DNA phosphodiesterase 19796VGNC:23971Inparanoid, OMA, EggNOG
Cow517053TDP1tyrosyl-DNA phosphodiesterase 19913VGNC:35713Inparanoid, OMA, EggNOG
Pig100153247TDP1tyrosyl-DNA phosphodiesterase 19823OMA, EggNOG
Opossum100015515TDP1tyrosyl-DNA phosphodiesterase 113616Inparanoid, EggNOG
Chicken423403TDP1tyrosyl-DNA phosphodiesterase 19031CGNC:8106Inparanoid, OMA, EggNOG
Anole lizard100563188tdp1tyrosyl-DNA phosphodiesterase 128377Inparanoid, OMA, EggNOG
Xenopus734106tdp1tyrosyl-DNA phosphodiesterase 18364XB-GENE-950568Inparanoid, OMA, EggNOG
Zebrafish571485tdp1tyrosyl-DNA phosphodiesterase 17955ZDB-GENE-090909-1Inparanoid, OMA, EggNOG
C. elegans176996F52C12.1Probable tyrosyl-DNA phosphodiesterase6239Inparanoid, OMA
Fruitfly33530gktglaikit7227FBgn0260817Inparanoid, OMA, EggNOG
S.cerevisiae852525TDP1tyrosyl-DNA phosphodiesterase 14932S000000427Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    phosphodiesterase    /    Tyrosyl-DNA phosphodiesterase 1
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Phosphodiesterase    /    Tyrosyl-DNA phosphodiesterase 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Pouliot, J J JJ, Yao, K C KC, Robertson, C A CA and Nash, H A HA. 1999-10-15 Yeast gene for a Tyr-DNA phosphodiesterase that repairs topoisomerase I complexes. [PMID:10521354]
      2.Interthal, H H, Pouliot, J J JJ and Champoux, J J JJ. 2001-10-09 The tyrosyl-DNA phosphodiesterase Tdp1 is a member of the phospholipase D superfamily. [PMID:11572945]
      3.Inamdar, Kedar V KV and 5 more authors. 2002-07-26 Conversion of phosphoglycolate to phosphate termini on 3' overhangs of DNA double strand breaks by the human tyrosyl-DNA phosphodiesterase hTdp1. [PMID:12023295]
      4.Takashima, Hiroshi H and 11 more authors. 2002-10 Mutation of TDP1, encoding a topoisomerase I-dependent DNA damage repair enzyme, in spinocerebellar ataxia with axonal neuropathy. [PMID:12244316]
      5.Davies, Douglas R DR, Interthal, Heidrun H, Champoux, James J JJ and Hol, Wim G J WG. 2002-12-13 Insights into substrate binding and catalytic mechanism of human tyrosyl-DNA phosphodiesterase (Tdp1) from vanadate and tungstate-inhibited structures. [PMID:12470949]
      6.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      7.Heilig, Roland R and 98 more authors. 2003-02-06 The DNA sequence and analysis of human chromosome 14. [PMID:12508121]
      8.Davies, Douglas R DR, Interthal, Heidrun H, Champoux, James J JJ and Hol, Wim G J WG. 2003-02 Crystal structure of a transition state mimic for Tdp1 assembled from vanadate, DNA, and a topoisomerase I-derived peptide. [PMID:12618186]
      9.Ota, Toshio T and 156 more authors. 2004-01 Complete sequencing and characterization of 21,243 full-length human cDNAs. [PMID:14702039]
      10.Davies, Douglas R DR, Interthal, Heidrun H, Champoux, James J JJ and Hol, Wim G J WG. 2004-02-12 Explorations of peptide and oligonucleotide binding sites of tyrosyl-DNA phosphodiesterase using vanadate complexes. [PMID:14761185]