The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ubiquitin-conjugating enzyme E2 N
| Gene ID | 7334 |
|---|
| uniprot | P61088 |
|---|
| Gene Name | UBE2N |
|---|
| Ensernbl ID | ENSP00000316176 |
|---|
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
|---|
| Sequence | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7334 | UBE2N | Ubiquitin-conjugating enzyme E2 N | P61088 |
| MOUSE | | Ube2n | Ubiquitin-conjugating enzyme E2 N | A0A1W2P7Z3 |
| MOUSE | 93765 | Ube2n | MCG4297 | A2RTT4 |
| MOUSE | 93765 | Ube2n | Ubiquitin-conjugating enzyme E2 N | P61089 |
| RAT | 116725 | Ube2n | Ubiquitin-conjugating enzyme E2 N | Q9EQX9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
