The store will not work correctly when cookies are disabled.
UBE2N
| Description | Ubiquitin-conjugating enzyme E2 N |
|---|
Gene and Protein Information
| Gene ID | 7334 |
|---|
| Uniprot Accession IDs | Q16781 Q53Y81 |
|---|
| Ensembl ID | ENSP00000316176 |
|---|
| Symbol | BLU UBC13 UbcH13 HEL-S-71 UbcH-ben UBCHBEN; UBC13 |
|---|
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
|---|
| Sequence | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452125 | UBE2N | ubiquitin conjugating enzyme E2 N | 9598 | VGNC:5641 | OMA, EggNOG |
| Macaque | 715437 | UBE2N | ubiquitin conjugating enzyme E2 N | 9544 | | Inparanoid, OMA |
| Mouse | 93765 | Ube2n | ubiquitin-conjugating enzyme E2N | 10090 | MGI:1934835 | Inparanoid, OMA, EggNOG |
| Rat | 116725 | Ube2n | ubiquitin-conjugating enzyme E2N | 10116 | RGD:621096 | Inparanoid, OMA |
| Horse | 102150222 | LOC102150222 | ubiquitin-conjugating enzyme E2 N | 9796 | | OMA, EggNOG |
| Cow | 541130 | UBE2N | ubiquitin conjugating enzyme E2 N | 9913 | VGNC:36590 | Inparanoid, OMA, EggNOG |
| Opossum | 100011853 | UBE2N | ubiquitin conjugating enzyme E2 N | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560649 | ube2n | ubiquitin conjugating enzyme E2 N | 28377 | | OMA, EggNOG |
| Xenopus | 395006 | ube2n | ubiquitin conjugating enzyme E2 N | 8364 | XB-GENE-943749 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393313 | ube2nb | ubiquitin-conjugating enzyme E2Nb | 7955 | ZDB-GENE-040426-1291 | Inparanoid, OMA, EggNOG |
| C. elegans | 177073 | ubc-13 | Ubiquitin-conjugating enzyme E2 13 | 6239 | | OMA, EggNOG |
| S.cerevisiae | 851666 | UBC13 | E2 ubiquitin-conjugating protein UBC13 | 4932 | S000002499 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
