Protein or Target Summary

Ubiquitin carboxyl-terminal hydrolase isozyme L3

Gene ID	7347
uniprot	P15374
Gene Name	UCHL3
Ensernbl ID	ENSP00000366819
Family	Belongs to the peptidase C12 family.
Sequence	MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7347	UCHL3	Ubiquitin carboxyl-terminal hydrolase isozyme L3	P15374
MOUSE	50933	Uchl3	Ubiquitin carboxyl-terminal hydrolase	Q8BWQ9
MOUSE		Uchl3	Ubiquitin carboxyl-terminal hydrolase	A0A2I3BQ39
MOUSE	50933	Uchl3	Ubiquitin carboxyl-terminal hydrolase isozyme L3	Q9JKB1
RAT		Uchl3	Ubiquitin carboxyl-terminal hydrolase	D4ABI6
RAT	498560	Uchl3	Ubiquitin carboxyl-terminal hydrolase isozyme L3	Q91Y78

Protein Classes

PANTHER Classes
protein    /    cysteine protease    /    Ubiquitin carboxyl-terminal hydrolase isozyme L3
protein    /    protease    /    Ubiquitin carboxyl-terminal hydrolase isozyme L3
protein    /    hydrolase    /    Ubiquitin carboxyl-terminal hydrolase isozyme L3

DTO Classes
protein / Enzyme / Protease / Cysteine protease / Ubiquitin carboxyl-terminal hydrolase isozyme L3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx