ACVR1
| Description | Activin receptor type-1 |
|---|
Gene and Protein Information
| Gene ID | 90 |
|---|---|
| Uniprot Accession IDs | Q04771 |
| Ensembl ID | ENSP00000263640 |
| Symbol | ACVRLK2 FOP ALK2 SKR1 TSRI ACTRI ACVR1A ACVRLK2 |
| Family | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. |
| Sequence | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470565 | ACVR1 | activin A receptor type 1 | 9598 | VGNC:56 | OMA, EggNOG |
| Macaque | 697935 | ACVR1 | activin A receptor type 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 11477 | Acvr1 | activin A receptor, type 1 | 10090 | MGI:87911 | Inparanoid, OMA, EggNOG |
| Rat | 79558 | Acvr1 | activin A receptor type 1 | 10116 | RGD:620200 | Inparanoid, OMA, EggNOG |
| Dog | 478757 | ACVR1 | activin A receptor type 1 | 9615 | VGNC:37561 | Inparanoid, OMA |
| Horse | 100050899 | ACVR1 | activin A receptor type 1 | 9796 | VGNC:15035 | Inparanoid, OMA |
| Cow | 338068 | ACVR1 | activin A receptor type 1 | 9913 | VGNC:25592 | Inparanoid, OMA |
| Pig | 100152307 | ACVR1 | activin A receptor type 1 | 9823 | Inparanoid, OMA | |
| Opossum | 100021438 | ACVR1 | activin A receptor type 1 | 13616 | Inparanoid, OMA | |
| Anole lizard | 100552279 | acvr1 | activin A receptor type 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 550111 | acvr1 | activin A receptor type 1 | 8364 | XB-GENE-478850 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / protein kinase receptor / Activin receptor type-1
protein / receptor / TGF-beta receptor / Activin receptor type-1
protein / receptor / serine/threonine protein kinase receptor / Activin receptor type-1
protein / receptor / protein kinase / Activin receptor type-1
protein / receptor / transferase / Activin receptor type-1
protein / receptor / kinase / Activin receptor type-1
protein / receptor / protein kinase receptor / Activin receptor type-1
protein / receptor / TGF-beta receptor / Activin receptor type-1
protein / receptor / serine/threonine protein kinase receptor / Activin receptor type-1
protein / receptor / protein kinase / Activin receptor type-1
protein / receptor / transferase / Activin receptor type-1
protein / receptor / kinase / Activin receptor type-1
DTO Classes
protein / Kinase / Protein kinase / TKL group / STKR family / STKR Type 1 subfamily / Activin receptor type-1
protein / Kinase / Protein kinase / TKL group / STKR family / STKR Type 1 subfamily / Activin receptor type-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|