The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
ACVR1
Description | Activin receptor type-1 |
---|
Gene and Protein Information
Gene ID | 90 |
Uniprot Accession IDs | Q04771 |
Ensembl ID | ENSP00000263640 |
Symbol | ACVRLK2 FOP ALK2 SKR1 TSRI ACTRI ACVR1A ACVRLK2 |
Family | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. |
Sequence | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 470565 | ACVR1 | activin A receptor type 1 | 9598 | VGNC:56 | OMA, EggNOG |
Macaque | 697935 | ACVR1 | activin A receptor type 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 11477 | Acvr1 | activin A receptor, type 1 | 10090 | MGI:87911 | Inparanoid, OMA, EggNOG |
Rat | 79558 | Acvr1 | activin A receptor type 1 | 10116 | RGD:620200 | Inparanoid, OMA, EggNOG |
Dog | 478757 | ACVR1 | activin A receptor type 1 | 9615 | VGNC:37561 | Inparanoid, OMA |
Horse | 100050899 | ACVR1 | activin A receptor type 1 | 9796 | VGNC:15035 | Inparanoid, OMA |
Cow | 338068 | ACVR1 | activin A receptor type 1 | 9913 | VGNC:25592 | Inparanoid, OMA |
Pig | 100152307 | ACVR1 | activin A receptor type 1 | 9823 | | Inparanoid, OMA |
Opossum | 100021438 | ACVR1 | activin A receptor type 1 | 13616 | | Inparanoid, OMA |
Anole lizard | 100552279 | acvr1 | activin A receptor type 1 | 28377 | | Inparanoid, OMA |
Xenopus | 550111 | acvr1 | activin A receptor type 1 | 8364 | XB-GENE-478850 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!