Protein or Target Summary

5-hydroxytryptamine receptor 5A

Gene ID	3361
uniprot	P47898
Gene Name	HTR5A
Ensernbl ID	ENSP00000287907
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3361	HTR5A	5-hydroxytryptamine receptor 5A	P47898
MOUSE	15563	Htr5a	Uncharacterized protein	Q3UVG4
MOUSE		Htr5a	Uncharacterized protein	Q3TRD1
MOUSE	15563	Htr5a	5-hydroxytryptamine receptor 5A	P30966
RAT	25689	Htr5a	5-hydroxytryptamine receptor 5A	P35364

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / 5-hydroxytryptamine receptor 5a

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / 5-hydroxytryptamine receptor / 5-HT5 receptor / 5-hydroxytryptamine receptor 5a

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx