The store will not work correctly when cookies are disabled.
PRKAB2
| Description | 5'-AMP-activated protein kinase subunit beta-2 |
|---|
Gene and Protein Information
| Gene ID | 5565 |
|---|
| Uniprot Accession IDs | A8K9V5 B4DH06 Q5VXY0 AMPK subunit beta-2 |
|---|
| Ensembl ID | ENSP00000254101 |
|---|
| Family | Belongs to the 5'-AMP-activated protein kinase beta subunit family. |
|---|
| Sequence | MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 457245 | PRKAB2 | protein kinase AMP-activated non-catalytic subunit beta 2 | 9598 | VGNC:11802 | OMA, EggNOG |
| Horse | 100034095 | PRKAB2 | protein kinase AMP-activated non-catalytic subunit beta 2 | 9796 | VGNC:21837 | OMA, EggNOG |
| Cow | 512665 | PRKAB2 | protein kinase AMP-activated non-catalytic subunit beta 2 | 9913 | VGNC:33320 | OMA, EggNOG |
| Pig | 100157793 | PRKAB2 | protein kinase AMP-activated non-catalytic subunit beta 2 | 9823 | | OMA, EggNOG |
| Opossum | | PRKAB2 | protein kinase AMP-activated non-catalytic subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:9379] | 13616 | | OMA, EggNOG |
| Chicken | 427017 | PRKAB2 | protein kinase AMP-activated non-catalytic subunit beta 2 | 9031 | CGNC:1173 | OMA, EggNOG |
| Anole lizard | 100554551 | prkab2 | protein kinase AMP-activated non-catalytic subunit beta 2 | 28377 | | OMA, EggNOG |
| Xenopus | 100127782 | prkab2 | protein kinase, AMP-activated, beta 2 non-catalytic subunit | 8364 | XB-GENE-976418 | OMA, EggNOG |
| C. elegans | 181492 | aakb-1 | AMP-Activated Kinase Beta subunit | 6239 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
