The store will not work correctly when cookies are disabled.
CHRM5
Description | Muscarinic acetylcholine receptor M5 |
---|
Gene and Protein Information
Gene ID | 1133 |
Uniprot Accession IDs | Q96RG7 |
Ensembl ID | ENSP00000372750 |
Symbol | HM5 |
Family | Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM5 sub-subfamily. |
Sequence | MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 503515 | CHRM5 | cholinergic receptor muscarinic 5 | 9598 | VGNC:10166 | Inparanoid, OMA, EggNOG |
Macaque | 574330 | CHRM5 | cholinergic receptor muscarinic 5 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 213788 | Chrm5 | cholinergic receptor, muscarinic 5 | 10090 | MGI:109248 | Inparanoid, OMA, EggNOG |
Rat | 53949 | Chrm5 | cholinergic receptor, muscarinic 5 | 10116 | RGD:620027 | Inparanoid, OMA, EggNOG |
Dog | 487472 | CHRM5 | cholinergic receptor muscarinic 5 | 9615 | VGNC:39235 | Inparanoid, OMA |
Horse | 100057856 | CHRM5 | cholinergic receptor muscarinic 5 | 9796 | VGNC:16521 | Inparanoid, OMA |
Cow | 281686 | CHRM5 | cholinergic receptor muscarinic 5 | 9913 | VGNC:27321 | Inparanoid, OMA |
Chicken | 428881 | CHRM5 | cholinergic receptor muscarinic 5 | 9031 | CGNC:53502 | Inparanoid, OMA |
Anole lizard | 100562127 | chrm5 | cholinergic receptor muscarinic 5 | 28377 | | Inparanoid, OMA |
Xenopus | 100498518 | chrm5 | cholinergic receptor, muscarinic 5 | 8364 | XB-GENE-986590 | Inparanoid, OMA |
Zebrafish | 553978 | chrm5a | cholinergic receptor, muscarinic 5a | 7955 | ZDB-GENE-080723-32 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|