The store will not work correctly when cookies are disabled.
ACSL5
Description | Long-chain-fatty-acid--CoA ligase 5 |
---|
Gene and Protein Information
Gene ID | 51703 |
Uniprot Accession IDs | A6GV77 D3DRB3 Q6UX44 Q9UIU4 |
Ensembl ID | ENSP00000348429 |
Symbol | ACS5 FACL5 ACS2 ACS5 FACL5 |
Family | Belongs to the ATP-dependent AMP-binding enzyme family. |
Sequence | MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 450739 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9598 | VGNC:8880 | OMA, EggNOG |
Macaque | 696404 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9544 | | OMA, EggNOG |
Mouse | 433256 | Acsl5 | acyl-CoA synthetase long-chain family member 5 | 10090 | MGI:1919129 | Inparanoid, OMA, EggNOG |
Rat | 94340 | Acsl5 | acyl-CoA synthetase long-chain family member 5 | 10116 | RGD:69402 | Inparanoid, OMA, EggNOG |
Dog | 477820 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9615 | VGNC:37535 | Inparanoid, OMA, EggNOG |
Horse | 100059190 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9796 | VGNC:15007 | Inparanoid, OMA |
Cow | 514159 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9913 | VGNC:25567 | Inparanoid, OMA, EggNOG |
Platypus | 100082580 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 423896 | ACSL5 | acyl-CoA synthetase long-chain family member 5 | 9031 | CGNC:52076 | Inparanoid, OMA |
Anole lizard | 100561703 | acsl5 | acyl-CoA synthetase long chain family member 5 | 28377 | | Inparanoid, OMA, EggNOG |
Zebrafish | 447860 | acsl5 | acyl-CoA synthetase long chain family member 5 | 7955 | ZDB-GENE-040912-169 | Inparanoid, OMA, EggNOG |
C. elegans | 171643 | acs-13 | fatty Acid CoA Synthetase family | 6239 | | Inparanoid, OMA |
S.cerevisiae | 856734 | FAA2 | medium-chain fatty acid-CoA ligase FAA2 | 4932 | S000000817 | Inparanoid, OMA |
S.cerevisiae | 855288 | FAA4 | long-chain fatty acid-CoA ligase FAA4 | 4932 | S000004860 | OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
ligase / Long-chain-fatty-acid--CoA ligase 5
DTO Classes protein /
Enzyme /
Ligase / Long-chain-fatty-acid--CoA ligase 5
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|