Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

5-hydroxytryptamine receptor 4

Gene ID3360
uniprotQ13639
Gene NameHTR4
Ensernbl IDENSP00000353915
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN3360HTR45-hydroxytryptamine receptor 4Q13639
MOUSEHtr45-hydroxytryptamine receptor variant T2lG8H733
MOUSEHtr45-hydroxytryptamine receptor variant T3G8H735
MOUSEHtr45-hydroxytryptamine receptor variant T2sG8H734
MOUSEHtr45-hydroxytryptamine receptor variant T1G8H732
MOUSE15562Htr45-hydroxytryptamine receptor 4P97288
RATHtr45-hydroxytryptamine receptor 4F1LM90
RAT25324Htr45-hydroxytryptamine (Serotonin) receptor 4, isoform CRA_fC4WYH1
RAT25324Htr45-hydroxytryptamine (Serotonin) receptor 4, isoform CRA_eC4WYH2
RATHtr45-hydroxytryptamine receptor 4A0A140UHX7
RATHtr45-hydroxytryptamine (Serotonin) receptor 4C4WYH3
RATHtr45-hydroxytryptamine receptor 4A0A0G2QC07
RAT25324Htr45-hydroxytryptamine receptor 4Q62758

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 4
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT4 receptor    /    5-hydroxytryptamine receptor 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.