NUDT1
| Description | 7,8-dihydro-8-oxoguanine triphosphatase |
|---|
Gene and Protein Information
| Gene ID | 4521 |
|---|---|
| Uniprot Accession IDs | A4D205 Q6LES7 Q6P0Y6 Q7Z7N6 Q8IV95 Q9UBM0 Q9UBM9 |
| Ensembl ID | ENSP00000380241 |
| Symbol | MTH1 MTH1 |
| Family | Belongs to the Nudix hydrolase family. |
| Sequence | MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463225 | NUDT1 | nudix hydrolase 1 | 9598 | VGNC:4451 | OMA, EggNOG |
| Macaque | 713078 | NUDT1 | nudix hydrolase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17766 | Nudt1 | nudix (nucleoside diphosphate linked moiety X)-type motif 1 | 10090 | MGI:109280 | Inparanoid, OMA, EggNOG |
| Rat | 117260 | Nudt1 | nudix hydrolase 1 | 10116 | RGD:621080 | Inparanoid, OMA, EggNOG |
| Dog | 489894 | NUDT1 | nudix hydrolase 1 | 9615 | VGNC:44024 | Inparanoid, OMA, EggNOG |
| Horse | 100059629 | NUDT1 | nudix hydrolase 1 | 9796 | VGNC:20940 | Inparanoid, OMA, EggNOG |
| Cow | 525496 | NUDT1 | nudix hydrolase 1 | 9913 | VGNC:32325 | Inparanoid, OMA, EggNOG |
| Opossum | 100029290 | NUDT1 | nudix hydrolase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 416467 | NUDT1 | nudix hydrolase 1 | 9031 | CGNC:3119 | Inparanoid, OMA |
| Anole lizard | 100564610 | nudt1 | nudix hydrolase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448146 | nudt1 | nudix hydrolase 1 | 8364 | XB-GENE-975736 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406727 | nudt1 | nudix (nucleoside diphosphate linked moiety X)-type motif 1 | 7955 | ZDB-GENE-040426-2757 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transferase / phosphorylase / 7,8-dihydro-8-oxoguanine triphosphatase
protein / transferase / hydrolase / 7,8-dihydro-8-oxoguanine triphosphatase
protein / transferase / phosphorylase / 7,8-dihydro-8-oxoguanine triphosphatase
protein / transferase / hydrolase / 7,8-dihydro-8-oxoguanine triphosphatase
DTO Classes
protein / Enzyme / Transferase / Phosphorylase / 7,8-dihydro-8-oxoguanine triphosphatase
protein / Enzyme / Transferase / Phosphorylase / 7,8-dihydro-8-oxoguanine triphosphatase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|