The store will not work correctly when cookies are disabled.
PRKAG1
| Description | 5'-AMP-activated protein kinase subunit gamma-1 |
|---|
Gene and Protein Information
| Gene ID | 5571 |
|---|
| Uniprot Accession IDs | B4DDT7 Q8N7V9 AMPK gamma1 |
|---|
| Ensembl ID | ENSP00000323867 |
|---|
| Symbol | AMPKG |
|---|
| Family | Belongs to the 5'-AMP-activated protein kinase gamma subunit family. |
|---|
| Sequence | METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451872 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9598 | VGNC:8504 | OMA, EggNOG |
| Macaque | 709298 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9544 | | OMA, EggNOG |
| Mouse | 19082 | Prkag1 | protein kinase, AMP-activated, gamma 1 non-catalytic subunit | 10090 | MGI:108411 | OMA, EggNOG |
| Dog | 486559 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9615 | VGNC:44972 | OMA, EggNOG |
| Horse | 100034096 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9796 | VGNC:21839 | OMA, EggNOG |
| Cow | 282324 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9913 | VGNC:33322 | OMA, EggNOG |
| Pig | 414426 | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 | 9823 | | OMA, EggNOG |
| Opossum | | PRKAG1 | protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:9385] | 13616 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
