Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

PRKAG1

Description5'-AMP-activated protein kinase subunit gamma-1

Gene and Protein Information

Gene ID5571
Uniprot Accession IDs P54619 B4DDT7 Q8N7V9 AMPK gamma1
Ensembl ID ENSP00000323867
Symbol AMPKG
FamilyBelongs to the 5'-AMP-activated protein kinase gamma subunit family.
Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451872PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19598VGNC:8504OMA, EggNOG
Macaque709298PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19544OMA, EggNOG
Mouse19082Prkag1protein kinase, AMP-activated, gamma 1 non-catalytic subunit10090MGI:108411OMA, EggNOG
Dog486559PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19615VGNC:44972OMA, EggNOG
Horse100034096PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19796VGNC:21839OMA, EggNOG
Cow282324PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19913VGNC:33322OMA, EggNOG
Pig414426PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19823OMA, EggNOG
OpossumPRKAG1protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:9385]13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase modulator    /    5'-AMP-activated protein kinase subunit gamma-1
DTO Classes
protein    /    Kinase    /    Protein kinase    /    CAMK group    /    CAMKL family    /    5'-AMP-activated protein kinase subunit gamma-1

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      Attention deficit hyperactivity disorder0JensenLab Experiment TIGA
      Osteoporosis0JensenLab Experiment TIGA
      Bipolar disorder0JensenLab Experiment TIGA

      Bibliography

      1.Cheung, P C PC, Salt, I P IP, Davies, S P SP, Hardie, D G DG and Carling, D D. 2000-03-15 Characterization of AMP-activated protein kinase gamma-subunit isoforms and their role in AMP binding. [PMID:10698692]
      2.Hamilton, S R SR and 6 more authors. 2001-07-06 An activating mutation in the gamma1 subunit of the AMP-activated protein kinase. [PMID:11445078]
      3.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      4.Inoki, Ken K, Zhu, Tianqing T and Guan, Kun-Liang KL. 2003-11-26 TSC2 mediates cellular energy response to control cell growth and survival. [PMID:14651849]
      5.Ota, Toshio T and 156 more authors. 2004-01 Complete sequencing and characterization of 21,243 full-length human cDNAs. [PMID:14702039]
      6.Minokoshi, Yasuhiko Y and 11 more authors. 2004-04-01 AMP-kinase regulates food intake by responding to hormonal and nutrient signals in the hypothalamus. [PMID:15058305]
      7.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      8.Kahn, Barbara B BB, Alquier, Thierry T, Carling, David D and Hardie, D Grahame DG. 2005-01 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism. [PMID:16054041]
      9.Al-Hakim, Abdallah K AK and 7 more authors. 2005-12-01 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK. [PMID:16306228]
      10.Kimura, Kouichi K and 31 more authors. 2006-01 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. [PMID:16344560]