The store will not work correctly when cookies are disabled.
Protein or Target Summary
C-X-C motif chemokine 5
| Gene ID | 6374 |
|---|
| uniprot | P42830 |
|---|
| Gene Name | CXCL5 |
|---|
| Ensernbl ID | ENSP00000296027 |
|---|
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
|---|
| Sequence | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6374 | CXCL5 | C-X-C motif chemokine 5 | P42830 |
| MOUSE | 20311 | Cxcl5 | C-X-C motif chemokine 5 | P50228 |
| MOUSE | | Cxcl5 | C-X-C motif chemokine | Q790R4 |
| RAT | 60665 | Cxcl5 | C-X-C motif chemokine 5 | P97885 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
