Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Natriuretic peptides B

Gene ID4879
uniprotP16860
Gene NameNPPB
Ensernbl IDENSP00000365651
FamilyBelongs to the natriuretic peptide family.
Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN4879NPPBNatriuretic peptides BP16860
MOUSE18158NppbBrain natriuretic peptideQ54AE9
MOUSE18158NppbNatriuretic peptides BP40753
RAT25105NppbNatriuretic peptides BP13205

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source