The store will not work correctly when cookies are disabled.
NPPB
| Description | Natriuretic peptides B |
|---|
Gene and Protein Information
| Gene ID | 4879 |
|---|
| Uniprot Accession IDs | B0ZBE9 Q6FGY0 Q9P2Q7 |
|---|
| Ensembl ID | ENSP00000365651 |
|---|
| Symbol | BNP |
|---|
| Family | Belongs to the natriuretic peptide family. |
|---|
| Sequence | MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469801 | NPPB | natriuretic peptide B | 9598 | VGNC:1418 | OMA, EggNOG |
| Mouse | 18158 | Nppb | natriuretic peptide type B | 10090 | MGI:97368 | Inparanoid, OMA, EggNOG |
| Rat | 25105 | Nppb | natriuretic peptide B | 10116 | RGD:3194 | Inparanoid, OMA, EggNOG |
| Dog | 487441 | NPPB | natriuretic peptide B | 9615 | VGNC:43926 | Inparanoid, OMA, EggNOG |
| Horse | 100056123 | NPPB | natriuretic peptide B | 9796 | VGNC:20845 | Inparanoid, OMA, EggNOG |
| Cow | 508734 | NPPB | natriuretic peptide B | 9913 | VGNC:32211 | Inparanoid, OMA, EggNOG |
| Pig | 396844 | NPPB | natriuretic peptide B | 9823 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
