JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Transcription factor AP-2-beta

Gene ID	7021
uniprot	Q92481
Gene Name	TFAP2B
Ensernbl ID	ENSP00000377265
Family	Belongs to the AP-2 family.
Sequence	MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7021	TFAP2B	Transcription factor AP-2-beta	Q92481
MOUSE		Tfap2b	Uncharacterized protein	Q3UVE9
MOUSE	21419	Tfap2b	Uncharacterized protein	Q8CCV4
MOUSE	21419	Tfap2b	Transcription factor AP-2-beta	E9Q5N4
MOUSE		Tfap2b	Uncharacterized protein	Q8CBL0
MOUSE	21419	Tfap2b	Transcription factor AP-2-beta	Q8CE69
MOUSE	21419	Tfap2b	Transcription factor AP-2-beta	Q61313
RAT		Tfap2b	Transcription factor AP-2 beta	A0A0G2KAT2
RAT	301285	Tfap2b	Transcription factor AP-2 beta	D4A505

Protein Classes

PANTHER Classes
protein / transcription factor / Transcription factor AP-2-beta

DTO Classes
protein / Transcription factor / Transcription factor AP-2-beta

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx