The store will not work correctly when cookies are disabled.
ADORA2A
| Description | Adenosine receptor A2a |
|---|
Gene and Protein Information
| Gene ID | 135 |
|---|
| Uniprot Accession IDs | B2R7E0 |
|---|
| Ensembl ID | ENSP00000480012 |
|---|
| Symbol | ADORA2 A2aR RDC8 ADORA2 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 458714 | ADORA2A | adenosine A2a receptor | 9598 | VGNC:5238 | OMA, EggNOG |
| Macaque | 707865 | ADORA2A | adenosine A2a receptor | 9544 | | Inparanoid, OMA |
| Mouse | 11540 | Adora2a | adenosine A2a receptor | 10090 | MGI:99402 | Inparanoid, OMA, EggNOG |
| Rat | 25369 | Adora2a | adenosine A2a receptor | 10116 | RGD:2049 | Inparanoid, OMA, EggNOG |
| Dog | 403960 | ADORA2A | adenosine A2a receptor | 9615 | VGNC:37666 | Inparanoid, OMA, EggNOG |
| Cow | 617828 | ADORA2A | adenosine A2a receptor | 9913 | VGNC:25687 | Inparanoid, OMA, EggNOG |
| Pig | 503661 | ADORA2A | adenosine A2a receptor | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | ADORA2A | adenosine A2a receptor [Source:HGNC Symbol;Acc:HGNC:263] | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554785 | adora2a | adenosine A2a receptor | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100127551 | adora2a | adenosine A2a receptor | 8364 | XB-GENE-970783 | Inparanoid, OMA, EggNOG |
| Zebrafish | 561701 | adora2aa | adenosine A2a receptor a | 7955 | ZDB-GENE-080723-28 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
