The store will not work correctly when cookies are disabled.
ADORA2B
Description | Adenosine receptor A2b |
---|
Gene and Protein Information
Gene ID | 136 |
Uniprot Accession IDs | P29275 |
Ensembl ID | ENSP00000304501 |
Symbol | ADORA2 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 455009 | ADORA2B | adenosine A2b receptor | 9598 | VGNC:9120 | OMA, EggNOG |
Mouse | 11541 | Adora2b | adenosine A2b receptor | 10090 | MGI:99403 | Inparanoid, OMA, EggNOG |
Rat | 29316 | Adora2b | adenosine A2B receptor | 10116 | RGD:2050 | Inparanoid, OMA, EggNOG |
Dog | 403410 | ADORA2B | adenosine A2b receptor | 9615 | VGNC:37667 | Inparanoid, OMA, EggNOG |
Horse | 100063319 | ADORA2B | adenosine A2b receptor | 9796 | VGNC:15127 | Inparanoid, OMA, EggNOG |
Cow | 529760 | ADORA2B | adenosine A2b receptor | 9913 | VGNC:25688 | Inparanoid, OMA, EggNOG |
Opossum | | ADORA2B | adenosine A2b receptor [Source:HGNC Symbol;Acc:HGNC:264] | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 395971 | ADORA2B | adenosine A2b receptor | 9031 | CGNC:49582 | Inparanoid, OMA |
Zebrafish | 560100 | adora2b | adenosine A2b receptor | 7955 | ZDB-GENE-060511-1 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|