Protein or Target Summary
Neuronal acetylcholine receptor subunit alpha-4
Gene ID | 1137 |
---|---|
uniprot | P43681 |
Gene Name | CHRNA4 |
Ensernbl ID | ENSP00000359285 |
Family | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-4/CHRNA4 sub-subfamily. |
Sequence | MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 1137 | CHRNA4 | Neuronal acetylcholine receptor subunit alpha-4 | P43681 |
MOUSE | Chrna4 | Neuronal acetylcholine receptor subunit alpha-4 | B7ZBV1 | |
MOUSE | Chrna4 | Neuronal acetylcholine receptor subunit alpha-4 | A0A0G2JFP3 | |
MOUSE | Chrna4 | Neuronal acetylcholine receptor subunit alpha-4 | B7ZBU7 | |
MOUSE | 11438 | Chrna4 | Neuronal nicotinic acetylcholine receptor alpha4 subunit | Q53YK0 |
MOUSE | 11438 | Chrna4 | Neuronal acetylcholine receptor subunit alpha-4 | O70174 |
RAT | Chrna4 | Cholinergic receptor, nicotinic, alpha polypeptide 4, isoform CRA_a | A0A0G2K6W5 | |
RAT | Chrna4 | Neuronal acetylcholine receptor subunit alpha-4 | K4DIC3 | |
RAT | 25590 | Chrna4 | Neuronal acetylcholine receptor subunit alpha-4 | P09483 |
Protein Classes
PANTHER Classes
protein / transporter / ligand-gated ion channel / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / ion channel / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / acetylcholine receptor / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / GABA receptor / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / receptor / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / ligand-gated ion channel / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / ion channel / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / acetylcholine receptor / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / GABA receptor / Neuronal acetylcholine receptor subunit alpha-4
protein / transporter / receptor / Neuronal acetylcholine receptor subunit alpha-4
DTO Classes
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / Acetylcholine receptor subfamily / Alpha-4/CHRNA4 sub-subfamily / Neuronal acetylcholine receptor subunit alpha-4
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / Acetylcholine receptor subfamily / Alpha-4/CHRNA4 sub-subfamily / Neuronal acetylcholine receptor subunit alpha-4
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx