Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Neuronal acetylcholine receptor subunit alpha-4

Gene ID1137
uniprotP43681
Gene NameCHRNA4
Ensernbl IDENSP00000359285
FamilyBelongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-4/CHRNA4 sub-subfamily.
Sequence
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN1137CHRNA4Neuronal acetylcholine receptor subunit alpha-4P43681
MOUSEChrna4Neuronal acetylcholine receptor subunit alpha-4B7ZBV1
MOUSEChrna4Neuronal acetylcholine receptor subunit alpha-4A0A0G2JFP3
MOUSEChrna4Neuronal acetylcholine receptor subunit alpha-4B7ZBU7
MOUSE11438Chrna4Neuronal nicotinic acetylcholine receptor alpha4 subunitQ53YK0
MOUSE11438Chrna4Neuronal acetylcholine receptor subunit alpha-4O70174
RATChrna4Cholinergic receptor, nicotinic, alpha polypeptide 4, isoform CRA_aA0A0G2K6W5
RATChrna4Neuronal acetylcholine receptor subunit alpha-4K4DIC3
RAT25590Chrna4Neuronal acetylcholine receptor subunit alpha-4P09483

Protein Classes

PANTHER Classes
protein    /    transporter    /    ligand-gated ion channel    /    Neuronal acetylcholine receptor subunit alpha-4
protein    /    transporter    /    ion channel    /    Neuronal acetylcholine receptor subunit alpha-4
protein    /    transporter    /    acetylcholine receptor    /    Neuronal acetylcholine receptor subunit alpha-4
protein    /    transporter    /    GABA receptor    /    Neuronal acetylcholine receptor subunit alpha-4
protein    /    transporter    /    receptor    /    Neuronal acetylcholine receptor subunit alpha-4
DTO Classes
protein    /    Ion channel    /    Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family    /    Acetylcholine receptor subfamily    /    Alpha-4/CHRNA4 sub-subfamily    /    Neuronal acetylcholine receptor subunit alpha-4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source