The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
HTR1E
Description | 5-hydroxytryptamine receptor 1E |
---|
Gene and Protein Information
Gene ID | 3354 |
Uniprot Accession IDs | E1P503 Q9P1Y1 5-HT-1E |
Ensembl ID | ENSP00000307766 |
Symbol | 5-HT1E |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT Show more |
---|
Homologous gene and protein info.
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands