Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

HTR1E

Description5-hydroxytryptamine receptor 1E

Gene and Protein Information

Gene ID3354
Uniprot Accession IDs E1P503 Q9P1Y1 5-HT-1E
Ensembl ID ENSP00000307766
Symbol 5-HT1E
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp472064HTR1E5-hydroxytryptamine receptor 1E9598VGNC:7895OMA, EggNOG
Macaque697598HTR1E5-hydroxytryptamine receptor 1E9544Inparanoid, OMA, EggNOG
Horse100065574HTR1E5-hydroxytryptamine receptor 1E9796VGNC:18901Inparanoid, OMA
Cow616356HTR1E5-hydroxytryptamine receptor 1E9913VGNC:29994Inparanoid, OMA
Opossum100025139HTR1E5-hydroxytryptamine receptor 1E13616Inparanoid, OMA
Chicken771973HTR1E5-hydroxytryptamine receptor 1E9031CGNC:11809Inparanoid, OMA
Anole lizard100557862htr1e5-hydroxytryptamine receptor 1E28377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 1E
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT1 receptor    /    5-hydroxytryptamine receptor 1E

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      astrocytic glioma3773Expression AtlasMONDO:0021636
      diabetes mellitus1167Expression AtlasMONDO:0005015
      ependymoma5607Expression AtlasMONDO:0021191
      gastric carcinoma1287Expression AtlasMONDO:0004950
      oligodendroglioma2858Expression AtlasMONDO:0016695
      psoriasis6696Expression AtlasMONDO:0005083
      Atrial fibrillation0JensenLab Experiment TIGA
      Interstitial lung disease0JensenLab Experiment TIGA
      Migraine0DrugCentral Indication
      Postabortal Hemorrhage0DrugCentral Indication

      Bibliography

      1.Cargill, M M and 17 more authors. 1999-07 Characterization of single-nucleotide polymorphisms in coding regions of human genes. [PMID:10391209]
      2.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      3.Turecki, G G and 10 more authors. 2003-04-01 Suicide and serotonin: study of variation at seven serotonin receptor genes in suicide completers. [PMID:12627464]
      4.Mungall, A J AJ and 170 more authors. 2003-10-23 The DNA sequence and analysis of human chromosome 6. [PMID:14574404]
      5.Zgombick, J M JM and 5 more authors. 1992-08 Human gene S31 encodes the pharmacologically defined serotonin 5-hydroxytryptamine1E receptor. [PMID:1513320]
      6.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      7.McAllister, G G and 7 more authors. 1992-06-15 Molecular cloning of a serotonin receptor from human brain (5HT1E): a fifth 5HT1-like subtype. [PMID:1608964]
      8.Levy, F O FO, Gudermann, T T, Birnbaumer, M M, Kaumann, A J AJ and Birnbaumer, L L. 1992-01-20 Molecular cloning of a human gene (S31) encoding a novel serotonin receptor mediating inhibition of adenylyl cyclase. [PMID:1733778]
      9.Ewing, Rob M RM and 35 more authors. 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry. [PMID:17353931]
      10.Smith, Alicia K AK and 6 more authors. 2008-02 Genetic evaluation of the serotonergic system in chronic fatigue syndrome. [PMID:18079067]