JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

PRKAB1

Description	5'-AMP-activated protein kinase subunit beta-1

Gene and Protein Information

Gene ID	5564
Uniprot Accession IDs	Q9UBV0 Q9UE20 Q9UEX2 Q9Y6V8 AMPK subunit beta-1
Ensembl ID	ENSP00000229328
Symbol	AMPK AMPK HAMPKb
Family	Belongs to the 5'-AMP-activated protein kinase beta subunit family.
Sequence	MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	452297	PRKAB1	protein kinase AMP-activated non-catalytic subunit beta 1	9598	VGNC:8503	OMA, EggNOG
Macaque	695737	PRKAB1	protein kinase AMP-activated non-catalytic subunit beta 1	9544		OMA, EggNOG
Mouse	19079	Prkab1	protein kinase, AMP-activated, beta 1 non-catalytic subunit	10090	MGI:1336167	OMA, EggNOG
Rat	83803	Prkab1	protein kinase AMP-activated non-catalytic subunit beta 1	10116	RGD:71057	OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / kinase modulator / 5'-AMP-activated protein kinase subunit beta-1

DTO Classes
protein / Kinase / Protein kinase / CAMK group / CAMKL family / 5'-AMP-activated protein kinase subunit beta-1

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source