Protein or Target Summary

Eukaryotic translation initiation factor 4E-binding protein 1

Gene ID	1978
uniprot	Q13541
Gene Name	EIF4EBP1
Ensernbl ID	ENSP00000340691
Family	Belongs to the eIF4E-binding protein family.
Sequence	MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1978	EIF4EBP1	Eukaryotic translation initiation factor 4E-binding protein 1	Q13541
MOUSE		Eif4ebp1	Uncharacterized protein	Q3TII9
MOUSE	13685	Eif4ebp1	Eukaryotic translation initiation factor 4E-binding protein 1	Q60876
RAT	116636	Eif4ebp1	Eukaryotic translation initiation factor 4E-binding protein 1	Q62622

Protein Classes

PANTHER Classes
protein / nucleic acid binding / translation factor / Eukaryotic translation initiation factor 4E-binding protein 1

DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Eukaryotic translation initiation factor 4E-binding protein 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx