The store will not work correctly when cookies are disabled.
ABHD6
| Description | Monoacylglycerol lipase ABHD6 |
|---|
Gene and Protein Information
| Gene ID | 57406 |
|---|
| Uniprot Accession IDs | B2R7Y9 Q6ZMF7 |
|---|
| Ensembl ID | ENSP00000420315 |
|---|
| Family | Belongs to the AB hydrolase superfamily. |
|---|
| Sequence | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 470830 | ABHD6 | abhydrolase domain containing 6 | 9598 | VGNC:53352 | OMA, EggNOG |
| Macaque | 702384 | ABHD6 | abhydrolase domain containing 6 | 9544 | | Inparanoid, OMA |
| Mouse | 66082 | Abhd6 | abhydrolase domain containing 6 | 10090 | MGI:1913332 | Inparanoid, OMA, EggNOG |
| Rat | 305795 | Abhd6 | abhydrolase domain containing 6 | 10116 | RGD:1359323 | Inparanoid, OMA, EggNOG |
| Dog | 484712 | ABHD6 | abhydrolase domain containing 6 | 9615 | VGNC:37472 | Inparanoid, OMA, EggNOG |
| Horse | 100057821 | ABHD6 | abhydrolase domain containing 6 | 9796 | VGNC:14948 | Inparanoid, OMA |
| Cow | 505283 | ABHD6 | abhydrolase domain containing 6 | 9913 | VGNC:25503 | Inparanoid, OMA, EggNOG |
| Pig | 100515411 | ABHD6 | abhydrolase domain containing 6 | 9823 | | Inparanoid, OMA |
| Opossum | 100014368 | ABHD6 | abhydrolase domain containing 6 | 13616 | | Inparanoid, OMA |
| Platypus | 100093261 | ABHD6 | abhydrolase domain containing 6 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 416009 | ABHD6 | abhydrolase domain containing 6 | 9031 | CGNC:4246 | Inparanoid, OMA, EggNOG |
| Xenopus | 100145783 | abhd6 | abhydrolase domain containing 6 | 8364 | XB-GENE-966285 | Inparanoid, OMA, EggNOG |
| Zebrafish | 799085 | abhd6a | abhydrolase domain containing 6a | 7955 | ZDB-GENE-090925-1 | Inparanoid, OMA |
| S.cerevisiae | 855801 | YNR064C | epoxide hydrolase | 4932 | S000005347 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
serine protease / Monoacylglycerol lipase ABHD6
protein /
protease / Monoacylglycerol lipase ABHD6
protein /
hydrolase / Monoacylglycerol lipase ABHD6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
