Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
྾

ABHD6

DescriptionMonoacylglycerol lipase ABHD6

Gene and Protein Information

Gene ID57406
Uniprot Accession IDs Q9BV23 B2R7Y9 Q6ZMF7
Ensembl ID ENSP00000420315
FamilyBelongs to the AB hydrolase superfamily.
Sequence
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470830ABHD6abhydrolase domain containing 69598VGNC:53352OMA, EggNOG
Macaque702384ABHD6abhydrolase domain containing 69544Inparanoid, OMA
Mouse66082Abhd6abhydrolase domain containing 610090MGI:1913332Inparanoid, OMA, EggNOG
Rat305795Abhd6abhydrolase domain containing 610116RGD:1359323Inparanoid, OMA, EggNOG
Dog484712ABHD6abhydrolase domain containing 69615VGNC:37472Inparanoid, OMA, EggNOG
Horse100057821ABHD6abhydrolase domain containing 69796VGNC:14948Inparanoid, OMA
Cow505283ABHD6abhydrolase domain containing 69913VGNC:25503Inparanoid, OMA, EggNOG
Pig100515411ABHD6abhydrolase domain containing 69823Inparanoid, OMA
Opossum100014368ABHD6abhydrolase domain containing 613616Inparanoid, OMA
Platypus100093261ABHD6abhydrolase domain containing 69258Inparanoid, OMA, EggNOG
Chicken416009ABHD6abhydrolase domain containing 69031CGNC:4246Inparanoid, OMA, EggNOG
Xenopus100145783abhd6abhydrolase domain containing 68364XB-GENE-966285Inparanoid, OMA, EggNOG
Zebrafish799085abhd6aabhydrolase domain containing 6a7955ZDB-GENE-090925-1Inparanoid, OMA
S.cerevisiae855801YNR064Cepoxide hydrolase4932S000005347Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    serine protease    /    Monoacylglycerol lipase ABHD6
protein    /    protease    /    Monoacylglycerol lipase ABHD6
protein    /    hydrolase    /    Monoacylglycerol lipase ABHD6
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Monoacylglycerol lipase ABHD6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      2.Ota, Toshio T and 156 more authors. 2004-01 Complete sequencing and characterization of 21,243 full-length human cDNAs. [PMID:14702039]
      3.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      4.Kimura, Kouichi K and 31 more authors. 2006-01 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. [PMID:16344560]
      5.Li, Fan F, Fei, Xiangwei X, Xu, Jiaxi J and Ji, Chaoneng C. 2009-04 An unannotated alpha/beta hydrolase superfamily member, ABHD6 differentially expressed among cancer cell lines. [PMID:18360779]
      6.Max, Daniela D, Hesse, Manuela M, Volkmer, Ines I and Staege, Martin S MS. 2009-12 High expression of the evolutionarily conserved alpha/beta hydrolase domain containing 6 (ABHD6) in Ewing tumors. [PMID:19793082]
      7.Gaudet, Pascale P, Livstone, Michael S MS, Lewis, Suzanna E SE and Thomas, Paul D PD. 2011-09 Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium. [PMID:21873635]
      8.Long, Leonora E LE, Lind, Jonna J, Webster, Maree M and Weickert, Cynthia Shannon CS. 2012-07-24 Developmental trajectory of the endocannabinoid system in human dorsolateral prefrontal cortex. [PMID:22827915]
      9.Navia-Paldanius, Dina D, Savinainen, Juha R JR and Laitinen, Jarmo T JT. 2012-11 Biochemical and pharmacological characterization of human α/β-hydrolase domain containing 6 (ABHD6) and 12 (ABHD12). [PMID:22969151]
      10.Prunotto, Marco M and 7 more authors. 2013-04-26 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. [PMID:23376485]
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.