JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

AIF1

Description	Allograft inflammatory factor 1

Gene and Protein Information

Gene ID	199
Uniprot Accession IDs	A8K406 O43904 Q9UIV4 Q9UKS9 AIF-1
Ensembl ID	ENSP00000365227
Symbol	G1 IBA1 IBA1 IRT1 AIF-1 IRT-1
Sequence	MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	11629	Aif1	allograft inflammatory factor 1	10090	MGI:1343098	Inparanoid, OMA
Rat	29427	Aif1	allograft inflammatory factor 1	10116	RGD:61924	Inparanoid, OMA
Dog	474841	AIF1	allograft inflammatory factor 1	9615	VGNC:37735	Inparanoid, OMA
Horse	100050158	AIF1	allograft inflammatory factor 1	9796	VGNC:15185	Inparanoid, OMA, EggNOG
Cow	280989	AIF1	allograft inflammatory factor 1	9913	VGNC:25759	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / calcium-binding protein / calmodulin / Allograft inflammatory factor 1
protein / calcium-binding protein / annexin / Allograft inflammatory factor 1

DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Allograft inflammatory factor 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]