Protein or Target Summary

Apoptosis-inducing factor 1, mitochondrial

Gene ID	9131
uniprot	O95831
Gene Name	AIFM1
Ensernbl ID	ENSP00000287295
Family	Belongs to the FAD-dependent oxidoreductase family.
Sequence	MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9131	AIFM1	Apoptosis-inducing factor 1, mitochondrial	O95831
MOUSE	26926	Aifm1	Apoptosis-inducing factor 1, mitochondrial	B1AU25
MOUSE		Aifm1	Apoptosis-inducing factor short isoform 2	Q1L6K5
MOUSE	26926	Aifm1	Apoptosis-inducing factor 1, mitochondrial	Q9Z0X1
RAT		Aifm1	Apoptosis-inducing factor 1, mitochondrial	A0A0G2K7K2
RAT	83533	Aifm1	Apoptosis-inducing factor 1, mitochondrial	Q9JM53

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxidase    /    Apoptosis-inducing factor 1, mitochondrial
protein    /    oxidoreductase    /    dehydrogenase    /    Apoptosis-inducing factor 1, mitochondrial
protein    /    oxidoreductase    /    reductase    /    Apoptosis-inducing factor 1, mitochondrial

DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Apoptosis-inducing factor 1, mitochondrial

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx