The store will not work correctly when cookies are disabled.
Protein or Target Summary
Aldo-keto reductase family 1 member C2
| Gene ID | 1646 |
|---|
| uniprot | P52895 |
|---|
| Gene Name | AKR1C2 |
|---|
| Ensernbl ID | ENSP00000370129 |
|---|
| Family | Belongs to the aldo/keto reductase family. |
|---|
| Sequence | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1646 | AKR1C2 | Aldo-keto reductase family 1 member C2 | P52895 |
| RAT | | Akr1c2 | Aldo-keto reductase family 1, member C2 | F1LQ80 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
