The store will not work correctly when cookies are disabled.
Protein or Target Summary
Gastrin-releasing peptide
| Target ID | 1583 |
|---|
| Gene ID | 2922 |
|---|
| uniprot | P07492 |
|---|
| Gene Name | GRP |
|---|
| Ensernbl ID | ENSP00000256857 |
|---|
| Family | Belongs to the bombesin/neuromedin-B/ranatensin family. |
|---|
| Sequence | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2922 | GRP | Gastrin-releasing peptide | P07492 |
| MOUSE | 225642 | Grp | Gastrin-releasing peptide | Q8R1I2 |
| MOUSE | | Grp | Gastrin-releasing peptide | V9GX72 |
| RAT | 171101 | Grp | Gastrin-releasing peptide | P24393 |
Pathway
| Data Source | Name | Explore in Pharos | Explore in Source |
|---|
