The store will not work correctly when cookies are disabled.
GRP
| Description | Gastrin-releasing peptide |
|---|
Gene and Protein Information
| Gene ID | 2922 |
|---|
| Uniprot Accession IDs | P07491 P81553 Q14454 Q53YA0 Q9BSY7 GRP |
|---|
| Ensembl ID | ENSP00000256857 |
|---|
| Symbol | BN GRP-10 proGRP preproGRP |
|---|
| Family | Belongs to the bombesin/neuromedin-B/ranatensin family. |
|---|
| Sequence | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736808 | GRP | gastrin releasing peptide | 9598 | VGNC:7316 | OMA, EggNOG |
| Macaque | 696983 | GRP | gastrin releasing peptide | 9544 | | OMA, EggNOG |
| Mouse | 225642 | Grp | gastrin releasing peptide | 10090 | MGI:95833 | Inparanoid, OMA, EggNOG |
| Rat | 171101 | Grp | gastrin releasing peptide | 10116 | RGD:621740 | Inparanoid, OMA, EggNOG |
| Dog | 610154 | GRP | gastrin releasing peptide | 9615 | VGNC:53721 | OMA, EggNOG |
| Horse | 100050124 | GRP | gastrin releasing peptide | 9796 | VGNC:18608 | Inparanoid, OMA, EggNOG |
| Cow | 615323 | GRP | gastrin releasing peptide | 9913 | VGNC:29664 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
