MC2R

Description	Adrenocorticotropic hormone receptor

Gene and Protein Information

Gene ID	4158
Uniprot Accession IDs	A8K016 Q3MI45 Q504X6 ACTH receptor
Ensembl ID	ENSP00000333821
Symbol	ACTHR ACTHR
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	701312	MC2R	melanocortin 2 receptor	9544		Inparanoid, OMA, EggNOG
Mouse	17200	Mc2r	melanocortin 2 receptor	10090	MGI:96928	Inparanoid, OMA, EggNOG
Rat	282839	Mc2r	melanocortin 2 receptor	10116	RGD:628649	Inparanoid, OMA, EggNOG
Dog	100855756	MC2R	melanocortin 2 receptor	9615	VGNC:43066	Inparanoid, OMA, EggNOG
Horse	100057018	MC2R	melanocortin 2 receptor	9796	VGNC:20020	Inparanoid, OMA, EggNOG
Cow	281299	MC2R	melanocortin 2 receptor	9913	VGNC:31293	Inparanoid, OMA, EggNOG
Opossum	100018891	MC2R	melanocortin 2 receptor	13616		Inparanoid, OMA, EggNOG
Platypus	100076508	MC2R	melanocortin 2 receptor	9258		Inparanoid, OMA, EggNOG
Anole lizard		MC2R	melanocortin 2 receptor [Source:HGNC Symbol;Acc:HGNC:6930]	28377		Inparanoid, OMA
Zebrafish	353152	mc2r	melanocortin 2 receptor	7955	ZDB-GENE-030502-2	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / Adrenocorticotropic hormone receptor

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Melanocortin receptor / Adrenocorticotropic hormone receptor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source