Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
྾

ALOX5AP

DescriptionArachidonate 5-lipoxygenase-activating protein

Gene and Protein Information

Gene ID241
Uniprot Accession IDs P20292 Q5VV04
Ensembl ID ENSP00000479870
Symbol FLAP FLAP
FamilyBelongs to the MAPEG family.
Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452520ALOX5AParachidonate 5-lipoxygenase activating protein9598VGNC:7283OMA, EggNOG
Macaque713170ALOX5AParachidonate 5-lipoxygenase activating protein9544Inparanoid, OMA, EggNOG
Mouse11690Alox5aparachidonate 5-lipoxygenase activating protein10090MGI:107505Inparanoid, OMA, EggNOG
Rat29624Alox5aparachidonate 5-lipoxygenase activating protein10116RGD:2097Inparanoid, OMA, EggNOG
DogALOX5AParachidonate 5-lipoxygenase activating protein [Source:HGNC Symbol;Acc:HGNC:436]9615OMA, EggNOG
Horse100034178ALOX5AParachidonate 5-lipoxygenase activating protein9796Inparanoid, OMA, EggNOG
Cow613869ALOX5AParachidonate 5-lipoxygenase activating protein9913VGNC:25845Inparanoid, OMA, EggNOG
Pig397392ALOX5AParachidonate 5-lipoxygenase activating protein9823Inparanoid, OMA, EggNOG
Opossum100026200ALOX5AParachidonate 5-lipoxygenase activating protein13616Inparanoid, OMA, EggNOG
Platypus100079414ALOX5AParachidonate 5-lipoxygenase activating protein9258Inparanoid, OMA, EggNOG
Chicken770904ALOX5AParachidonate 5-lipoxygenase activating protein9031CGNC:66655Inparanoid, OMA
Anole lizard100560510alox5aparachidonate 5-lipoxygenase activating protein28377Inparanoid, OMA, EggNOG
Xenopus613083alox5aparachidonate 5-lipoxygenase activating protein8364XB-GENE-492422Inparanoid, OMA, EggNOG
Zebrafish337376alox5aparachidonate 5-lipoxygenase-activating protein7955ZDB-GENE-030131-9322Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    Arachidonate 5-lipoxygenase-activating protein
DTO Classes
protein    /    Enzyme    /    Transferase    /    Arachidonate 5-lipoxygenase-activating protein

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details
Recombinant FLAP AntibodyHuman
  • WB
Out of Stock
Expand⌵

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.