JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Arachidonate 5-lipoxygenase-activating protein

Gene ID	241
uniprot	P20292
Gene Name	ALOX5AP
Ensernbl ID	ENSP00000479870
Family	Belongs to the MAPEG family.
Sequence	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	241	ALOX5AP	Arachidonate 5-lipoxygenase-activating protein	P20292
MOUSE		Alox5ap	Arachidonate 5-lipoxygenase-activating protein	A0A0J9YUC8
MOUSE		Alox5ap	Arachidonate 5-lipoxygenase-activating protein	A0A0J9YV38
MOUSE	11690	Alox5ap	Arachidonate 5-lipoxygenase-activating protein	P30355
RAT	29624	Alox5ap	Arachidonate 5-lipoxygenase-activating protein	P20291

Protein Classes

PANTHER Classes
protein / transferase / Arachidonate 5-lipoxygenase-activating protein

DTO Classes
protein / Enzyme / Transferase / Arachidonate 5-lipoxygenase-activating protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx