The store will not work correctly when cookies are disabled.
Protein or Target Summary
C-X-C motif chemokine 17
| Gene ID | 284340 |
|---|
| uniprot | Q6UXB2 |
|---|
| Gene Name | CXCL17 |
|---|
| Ensernbl ID | ENSP00000472467 |
|---|
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
|---|
| Sequence | MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 284340 | CXCL17 | C-X-C motif chemokine 17 | Q6UXB2 |
| MOUSE | 232983 | Cxcl17 | C-X-C motif chemokine 17 | Q5UW37 |
| MOUSE | | Cxcl17 | Chemokine (C-X-C motif) ligand 17 | Q8R3U6 |
| MOUSE | | Cxcl17 | C-X-C motif chemokine 17 | E9Q192 |
| RAT | 308436 | Cxcl17 | C-X-C motif chemokine ligand 17 | D4A875 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
