The store will not work correctly when cookies are disabled.
CXCL17
| Description | C-X-C motif chemokine 17 |
|---|
Gene and Protein Information
| Gene ID | 284340 |
|---|
| Uniprot Accession IDs | A8KAC0 6-Cys CXCL17 |
|---|
| Ensembl ID | ENSP00000472467 |
|---|
| Symbol | VCC1 DMC VCC1 Dcip1 VCC-1 UNQ473 |
|---|
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
|---|
| Sequence | MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 741429 | CXCL17 | C-X-C motif chemokine ligand 17 | 9598 | VGNC:8294 | OMA, EggNOG |
| Mouse | 232983 | Cxcl17 | chemokine (C-X-C motif) ligand 17 | 10090 | MGI:2387642 | Inparanoid, OMA, EggNOG |
| Rat | 308436 | Cxcl17 | C-X-C motif chemokine ligand 17 | 10116 | RGD:1304717 | Inparanoid, OMA, EggNOG |
| Dog | 111090090 | CXCL17 | C-X-C motif chemokine ligand 17 | 9615 | VGNC:49733 | Inparanoid, OMA, EggNOG |
| Horse | 100629292 | CXCL17 | C-X-C motif chemokine ligand 17 | 9796 | VGNC:52369 | Inparanoid, OMA, EggNOG |
| Cow | 788717 | CXCL17 | C-X-C motif chemokine ligand 17 | 9913 | VGNC:27852 | Inparanoid, OMA, EggNOG |
| Pig | 100737180 | LOC100737180 | C-X-C motif chemokine 17-like | 9823 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
