Protein or Target Summary
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
| Gene ID | 60496 |
|---|---|
| uniprot | Q9NRN7 |
| Gene Name | AASDHPPT |
| Ensernbl ID | ENSP00000278618 |
| Family | Belongs to the P-Pant transferase superfamily. AcpS family. |
| Sequence | MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 60496 | AASDHPPT | L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase | Q9NRN7 |
| MOUSE | Aasdhppt | Aasdhppt protein | Q05C25 | |
| MOUSE | Aasdhppt | L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase | A0A1D5RL91 | |
| MOUSE | 67618 | Aasdhppt | L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase | Q9CQF6 |
| RAT | 300328 | Aasdhppt | L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase | B2RYJ4 |
Protein Classes
PANTHER Classes
protein / transferase / L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
protein / transferase / L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
DTO Classes
protein / Enzyme / Transferase / L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
protein / Enzyme / Transferase / L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx