JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Aldo-keto reductase family 1 member C1

Gene ID	1645
uniprot	Q04828
Gene Name	AKR1C1
Ensernbl ID	ENSP00000370254
Family	Belongs to the aldo/keto reductase family.
Sequence	MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1645	AKR1C1	Aldo-keto reductase family 1 member C1	Q04828
RAT		Akr1c1	Akr1c1 protein	Q5I0L1
RAT	307092	Akr1c1	Aldo-keto reductase family 1, member C1	Q3MHS3

Protein Classes

PANTHER Classes
protein / oxidoreductase / reductase / Aldo-keto reductase family 1 member C1

DTO Classes
protein / Enzyme / Oxidoreductase / Reductase / Aldo-keto reductase family 1 member C1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx