JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

FAD-linked sulfhydryl oxidase ALR

Gene ID	2671
uniprot	P55789
Gene Name	GFER
Ensernbl ID	ENSP00000248114
Sequence	MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2671	GFER	FAD-linked sulfhydryl oxidase ALR	P55789
MOUSE	11692	Gfer	FAD-linked sulfhydryl oxidase ALR	P56213
RAT	27100	Gfer	FAD-linked sulfhydryl oxidase ALR	Q63042

Protein Classes

PANTHER Classes
protein / oxidoreductase / oxidase / FAD-linked sulfhydryl oxidase ALR

DTO Classes
protein / Enzyme / Oxidoreductase / Oxidase / FAD-linked sulfhydryl oxidase ALR

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx