The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 6923 |
|---|
| Uniprot Accession IDs | B7WPD3 EloB |
|---|
| Ensembl ID | ENSP00000262306 |
|---|
| Symbol | TCEB2 SIII TCEB2 |
|---|
| Sequence | MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 739191 | LOC739191 | transcription elongation factor B polypeptide 2-like | 9598 | | OMA, EggNOG |
| Mouse | 67673 | Elob | elongin B | 10090 | MGI:1914923 | Inparanoid, OMA, EggNOG |
| Rat | 81807 | Elob | elongin B | 10116 | RGD:621200 | Inparanoid, OMA |
| Rat | | AABR07068955.1 | - | 10116 | | OMA, EggNOG |
| Dog | 479873 | ELOB | elongin B | 9615 | VGNC:40316 | OMA, EggNOG |
| Cow | 617277 | ELOB | elongin B | 9913 | | OMA, EggNOG |
| Pig | 100519651 | ELOB | elongin B | 9823 | | OMA, EggNOG |
| Opossum | 100018279 | ELOB | elongin B | 13616 | | OMA, EggNOG |
| Platypus | 100090222 | ELOB | elongin B | 9258 | | OMA, EggNOG |
| Anole lizard | 100562302 | elob | elongin B | 28377 | | OMA, EggNOG |
| Xenopus | 394559 | elob | elongin B | 8364 | XB-GENE-959169 | OMA, EggNOG |
| C. elegans | 176605 | elb-1 | ELongin B | 6239 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
