| Description | AP-3 complex subunit mu-1 |
|---|
Gene and Protein Information
| Gene ID | 26985 |
|---|---|
| Uniprot Accession IDs | Q5JQ12 Q9H5L2 |
| Ensembl ID | ENSP00000347408 |
| Family | Belongs to the adaptor complexes medium subunit family. |
| Sequence | MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450532 | AP3M1 | adaptor related protein complex 3 subunit mu 1 | 9598 | VGNC:7219 | OMA, EggNOG |
| Macaque | 705729 | AP3M1 | adaptor related protein complex 3 mu 1 subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 55946 | Ap3m1 | adaptor-related protein complex 3, mu 1 subunit | 10090 | MGI:1929212 | Inparanoid, OMA, EggNOG |
| Rat | 171126 | Ap3m1 | adaptor related protein complex 3 subunit mu 1 | 10116 | RGD:620417 | Inparanoid, OMA, EggNOG |
| Dog | 489052 | AP3M1 | adaptor related protein complex 3 subunit mu 1 | 9615 | VGNC:37966 | Inparanoid, OMA, EggNOG |
| Horse | 100064191 | AP3M1 | adaptor related protein complex 3 subunit mu 1 | 9796 | VGNC:15385 | Inparanoid, OMA, EggNOG |
| Cow | 514761 | AP3M1 | adaptor related protein complex 3 subunit mu 1 | 9913 | VGNC:25989 | Inparanoid, OMA, EggNOG |
| Pig | 100155017 | AP3M1 | adaptor related protein complex 3 mu 1 subunit | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011014 | AP3M1 | adaptor related protein complex 3 mu 1 subunit | 13616 | Inparanoid, EggNOG | |
| Platypus | 100075083 | AP3M1 | adaptor related protein complex 3 mu 1 subunit | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 423736 | AP3M1 | adaptor related protein complex 3 mu 1 subunit | 9031 | CGNC:52039 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / extracellular matrix protein / extracellular matrix glycoprotein / AP-3 complex subunit mu-1
protein / extracellular matrix protein / receptor / AP-3 complex subunit mu-1
protein / extracellular matrix protein / extracellular matrix glycoprotein / AP-3 complex subunit mu-1
protein / extracellular matrix protein / receptor / AP-3 complex subunit mu-1
DTO Classes
protein / Extracellular structure / Extracellular matrix glycoprotein / AP-3 complex subunit mu-1
protein / Extracellular structure / Extracellular matrix glycoprotein / AP-3 complex subunit mu-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|