Protein or Target Summary
AP-3 complex subunit mu-1
| Gene ID | 26985 |
|---|---|
| uniprot | Q9Y2T2 |
| Gene Name | AP3M1 |
| Ensernbl ID | ENSP00000347408 |
| Family | Belongs to the adaptor complexes medium subunit family. |
| Sequence | MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 26985 | AP3M1 | AP-3 complex subunit mu-1 | Q9Y2T2 |
| MOUSE | 55946 | Ap3m1 | AP-3 complex subunit mu-1 | Q9JKC8 |
| MOUSE | Ap3m1 | Uncharacterized protein | Q9DBU8 | |
| MOUSE | Ap3m1 | AP-3 complex subunit mu-1 | H7BWY2 | |
| MOUSE | Ap3m1 | AP-3 complex subunit mu-1 | D6RI63 | |
| MOUSE | Ap3m1 | AP-3 complex subunit mu-1 | D3YXV9 | |
| MOUSE | Ap3m1 | Ap3m1 protein | Q921U0 | |
| MOUSE | Ap3m1 | AP-3 complex subunit mu-1 | D3YWU3 | |
| MOUSE | Ap3m1 | AP-3 complex subunit mu-1 | A0A286YDZ6 | |
| RAT | 171126 | Ap3m1 | AP-3 complex subunit mu-1 | Q6IRG9 |
| RAT | Ap3m1 | AP-3 complex subunit mu-1 | P53676 |
Protein Classes
PANTHER Classes
protein / extracellular matrix protein / extracellular matrix glycoprotein / AP-3 complex subunit mu-1
protein / extracellular matrix protein / receptor / AP-3 complex subunit mu-1
protein / extracellular matrix protein / extracellular matrix glycoprotein / AP-3 complex subunit mu-1
protein / extracellular matrix protein / receptor / AP-3 complex subunit mu-1
DTO Classes
protein / Extracellular structure / Extracellular matrix glycoprotein / AP-3 complex subunit mu-1
protein / Extracellular structure / Extracellular matrix glycoprotein / AP-3 complex subunit mu-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx