Protein or Target Summary
ETS-related transcription factor Elf-3
Gene ID | 1999 |
---|---|
uniprot | P78545 |
Gene Name | ELF3 |
Ensernbl ID | ENSP00000352673 |
Family | Belongs to the ETS family. |
Sequence | MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / transcription factor / ETS-related transcription factor Elf-3
protein / signaling molecule / ETS-related transcription factor Elf-3
protein / winged helix/forkhead transcription factor / ETS-related transcription factor Elf-3
protein / nucleic acid binding / ETS-related transcription factor Elf-3
protein / transcription factor / ETS-related transcription factor Elf-3
protein / signaling molecule / ETS-related transcription factor Elf-3
protein / winged helix/forkhead transcription factor / ETS-related transcription factor Elf-3
protein / nucleic acid binding / ETS-related transcription factor Elf-3
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / ETS-related transcription factor Elf-3
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / ETS-related transcription factor Elf-3
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx