The store will not work correctly when cookies are disabled.
AKR1B1
| Description | Aldose reductase |
|---|
Gene and Protein Information
| Gene ID | 231 |
|---|
| Uniprot Accession IDs | B2R8N3 Q5U031 Q6FGA4 Q6ICP2 Q9BS21 Q9UCI9 AR |
|---|
| Ensembl ID | ENSP00000285930 |
|---|
| Symbol | ALDR1 AR ADR ALR2 ALDR1 |
|---|
| Family | Belongs to the aldo/keto reductase family. |
|---|
| Sequence | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737737 | AKR1B1 | aldo-keto reductase family 1 member B | 9598 | VGNC:13628 | OMA, EggNOG |
| Mouse | 11677 | Akr1b3 | aldo-keto reductase family 1, member B3 (aldose reductase) | 10090 | MGI:1353494 | Inparanoid, OMA, EggNOG |
| Rat | 24192 | Akr1b1 | aldo-keto reductase family 1 member B | 10116 | RGD:2092 | Inparanoid, OMA, EggNOG |
| Horse | 100065145 | AKR1B1 | aldo-keto reductase family 1 member B | 9796 | VGNC:15214 | Inparanoid, OMA, EggNOG |
| Cow | 317748 | AKR1B1 | aldo-keto reductase family 1, member B1 (aldose reductase) | 9913 | | Inparanoid, OMA |
| Opossum | 100021757 | AKR1B1 | aldo-keto reductase family 1 member B | 13616 | | Inparanoid, OMA |
| Platypus | 100075884 | LOC100075884 | aldose reductase-like | 9258 | | OMA, EggNOG |
| Anole lizard | 100564587 | LOC100564587 | aldose reductase | 28377 | | Inparanoid, EggNOG |
| Xenopus | 496546 | akr1b1 | aldo-keto reductase family 1, member B1 (aldose reductase) | 8364 | XB-GENE-5821742 | OMA, EggNOG |
| Zebrafish | 415138 | akr1b1 | aldo-keto reductase family 1, member B1 (aldose reductase) | 7955 | ZDB-GENE-040625-7 | Inparanoid, OMA |
| Zebrafish | 553452 | si:dkey-180p18.9 | si:dkey-180p18.9 | 7955 | ZDB-GENE-041210-132 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
