The store will not work correctly when cookies are disabled.
ANGPT2
Description | Angiopoietin-2 |
---|
Gene and Protein Information
Gene ID | 285 |
Uniprot Accession IDs | A0AV38 A8K205 B7ZLM7 Q9NRR7 Q9P2Y7 ANG-2 |
Ensembl ID | ENSP00000314897 |
Symbol | ANG2 AGPT2 |
Sequence | MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 742508 | ANGPT2 | angiopoietin 2 | 9598 | VGNC:921 | OMA, EggNOG |
Macaque | 716811 | ANGPT2 | angiopoietin 2 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 11601 | Angpt2 | angiopoietin 2 | 10090 | MGI:1202890 | Inparanoid, OMA, EggNOG |
Rat | 89805 | Angpt2 | angiopoietin 2 | 10116 | RGD:621861 | Inparanoid, OMA, EggNOG |
Dog | 607616 | ANGPT2 | angiopoietin 2 | 9615 | VGNC:37855 | Inparanoid, OMA, EggNOG |
Horse | 100051890 | ANGPT2 | angiopoietin 2 | 9796 | VGNC:15299 | Inparanoid, OMA, EggNOG |
Cow | 282141 | ANGPT2 | angiopoietin 2 | 9913 | VGNC:25888 | Inparanoid, OMA, EggNOG |
Pig | 396730 | ANGPT2 | angiopoietin 2 | 9823 | | Inparanoid, OMA |
Opossum | 100028850 | ANGPT2 | angiopoietin 2 | 13616 | | Inparanoid, EggNOG |
Platypus | 100073414 | ANGPT2 | angiopoietin 2 | 9258 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100554406 | angpt2 | angiopoietin 2 | 28377 | | Inparanoid, OMA |
Protein Classes
DTO Classes protein /
Signaling / Angiopoietin-2
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|