The store will not work correctly when cookies are disabled.
YWHAG
| Description | 14-3-3 protein gamma |
|---|
Gene and Protein Information
| Gene ID | 7532 |
|---|
| Uniprot Accession IDs | O70457 P35214 Q6FH52 Q9UDP2 Q9UN99 |
|---|
| Ensembl ID | ENSP00000306330 |
|---|
| Symbol | EIEE56 PPP1R170 14-3-3GAMMA |
|---|
| Family | Belongs to the 14-3-3 family. |
|---|
| Sequence | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 463489 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 9598 | VGNC:8791 | OMA, EggNOG |
| Macaque | 715517 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 22628 | Ywhag | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide | 10090 | MGI:108109 | Inparanoid, OMA, EggNOG |
| Rat | 56010 | Ywhag | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma | 10116 | RGD:62002 | Inparanoid, OMA, EggNOG |
| Dog | 489818 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 9615 | VGNC:48509 | Inparanoid, OMA |
| Horse | 100059731 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 9796 | VGNC:25119 | Inparanoid, OMA |
| Cow | 286862 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 9913 | VGNC:37046 | Inparanoid, OMA |
| Opossum | 100029105 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 13616 | | Inparanoid, OMA |
| Chicken | 427820 | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 9031 | CGNC:53200 | Inparanoid, OMA |
| Anole lizard | 100566139 | ywhag | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 28377 | | Inparanoid, OMA |
| Xenopus | 779762 | ywhag | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma | 8364 | XB-GENE-951350 | Inparanoid, OMA |
| Zebrafish | 117604 | ywhag1 | 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1 | 7955 | ZDB-GENE-011115-1 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
chaperone / 14-3-3 protein gamma
DTO Classes protein /
Chaperone / 14-3-3 protein gamma
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
