The store will not work correctly when cookies are disabled.
Protein or Target Summary
14-3-3 protein gamma
| Gene ID | 7532 |
|---|
| uniprot | P61981 |
|---|
| Gene Name | YWHAG |
|---|
| Ensernbl ID | ENSP00000306330 |
|---|
| Family | Belongs to the 14-3-3 family. |
|---|
| Sequence | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7532 | YWHAG | 14-3-3 protein gamma | P61981 |
| MOUSE | | Ywhag | Uncharacterized protein | Q3TP56 |
| MOUSE | 22628 | Ywhag | 14-3-3 protein gamma subtype | A8IP69 |
| MOUSE | 22628 | Ywhag | 14-3-3 protein gamma | P61982 |
| RAT | 56010 | Ywhag | 14-3-3 protein gamma | P61983 |
Protein Classes
PANTHER Classes protein /
chaperone / 14-3-3 protein gamma
DTO Classes protein /
Chaperone / 14-3-3 protein gamma
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
