Protein or Target Summary
5-hydroxytryptamine receptor 3B
| Gene ID | 9177 |
|---|---|
| uniprot | O95264 |
| Gene Name | HTR3B |
| Ensernbl ID | ENSP00000260191 |
| Family | Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3B sub-subfamily. |
| Sequence | MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / transporter / ligand-gated ion channel / 5-hydroxytryptamine receptor 3B
protein / transporter / ion channel / 5-hydroxytryptamine receptor 3B
protein / transporter / acetylcholine receptor / 5-hydroxytryptamine receptor 3B
protein / transporter / GABA receptor / 5-hydroxytryptamine receptor 3B
protein / transporter / receptor / 5-hydroxytryptamine receptor 3B
protein / transporter / ligand-gated ion channel / 5-hydroxytryptamine receptor 3B
protein / transporter / ion channel / 5-hydroxytryptamine receptor 3B
protein / transporter / acetylcholine receptor / 5-hydroxytryptamine receptor 3B
protein / transporter / GABA receptor / 5-hydroxytryptamine receptor 3B
protein / transporter / receptor / 5-hydroxytryptamine receptor 3B
DTO Classes
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / 5-hydroxytryptamine receptor subfamily / 5-HT3 receptor sub-subfamily / 5-hydroxytryptamine receptor 3B
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / 5-hydroxytryptamine receptor subfamily / 5-HT3 receptor sub-subfamily / 5-hydroxytryptamine receptor 3B
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx