The store will not work correctly when cookies are disabled.
Protein or Target Summary
Aspartate aminotransferase, mitochondrial
| Gene ID | 2806 |
|---|
| uniprot | P00505 |
|---|
| Gene Name | GOT2 |
|---|
| Ensernbl ID | ENSP00000245206 |
|---|
| Family | Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. |
|---|
| Sequence | MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2806 | GOT2 | Aspartate aminotransferase, mitochondrial | P00505 |
| MOUSE | 14719 | Got2 | Aspartate aminotransferase, mitochondrial | P05202 |
| RAT | 25721 | Got2 | Aspartate aminotransferase, mitochondrial | P00507 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
