The store will not work correctly when cookies are disabled.
SERPINA1
| Description | Alpha-1-antitrypsin |
|---|
Gene and Protein Information
| Gene ID | 5265 |
|---|
| Uniprot Accession IDs | A6PX14 B2RDQ8 Q0PVP5 Q13672 Q53XB8 Q5U0M1 Q7M4R2 Q86U18 Q86U19 Q96BF9 Q96ES1 Q9P1P0 Q9UCE6 Q9UCM3 |
|---|
| Ensembl ID | ENSP00000416066 |
|---|
| Symbol | AAT PI PI A1A AAT PI1 A1AT nNIF PRO2275 alpha1AT |
|---|
| Family | Belongs to the serpin family. |
|---|
| Sequence | MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 467541 | SERPINA1 | serpin family A member 1 | 9598 | | OMA, EggNOG |
| Macaque | 701361 | SERPINA1 | serpin family A member 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20704 | Serpina1e | serine (or cysteine) peptidase inhibitor, clade A, member 1E | 10090 | MGI:891967 | Inparanoid, OMA |
| Mouse | 20702 | Serpina1c | serine (or cysteine) peptidase inhibitor, clade A, member 1C | 10090 | MGI:891969 | OMA, EggNOG |
| Rat | 24648 | Serpina1 | serpin family A member 1 | 10116 | RGD:3326 | Inparanoid, OMA, EggNOG |
| Dog | 480422 | SERPINA1 | serpin family A member 1 | 9615 | VGNC:51681 | Inparanoid, OMA, EggNOG |
| Horse | 100065191 | LOC100065191 | alpha-1-antiproteinase 2-like | 9796 | | Inparanoid, OMA |
| Horse | 100065068 | LOC100065068 | alpha-1-antiproteinase 2-like | 9796 | | OMA, EggNOG |
| Cow | 280699 | SERPINA1 | serpin family A member 1 | 9913 | VGNC:53953 | Inparanoid, OMA, EggNOG |
| Pig | 397688 | SERPINA1 | serpin family A member 1 | 9823 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
