The store will not work correctly when cookies are disabled.
HTR2C
| Description | 5-hydroxytryptamine receptor 2C |
|---|
Gene and Protein Information
| Gene ID | 3358 |
|---|
| Uniprot Accession IDs | B1AMW4 Q5VUF8 Q9NP28 5-HT-2C |
|---|
| Ensembl ID | ENSP00000276198 |
|---|
| Symbol | HTR1C HTR1C 5-HT1C 5-HT2C 5HTR2C 5-HTR2C |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 473740 | HTR2C | 5-hydroxytryptamine receptor 2C | 9598 | VGNC:7460 | Inparanoid, OMA, EggNOG |
| Macaque | 708141 | HTR2C | 5-hydroxytryptamine receptor 2C | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 15560 | Htr2c | 5-hydroxytryptamine (serotonin) receptor 2C | 10090 | MGI:96281 | Inparanoid, OMA, EggNOG |
| Rat | 25187 | Htr2c | 5-hydroxytryptamine receptor 2C | 10116 | RGD:2848 | Inparanoid, OMA, EggNOG |
| Dog | 450240 | HTR2C | 5-hydroxytryptamine receptor 2C | 9615 | VGNC:41828 | Inparanoid, OMA, EggNOG |
| Horse | 100057852 | HTR2C | 5-hydroxytryptamine receptor 2C | 9796 | VGNC:18905 | Inparanoid, OMA, EggNOG |
| Pig | 100524920 | HTR2C | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100011052 | HTR2C | 5-hydroxytryptamine receptor 2C | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100496012 | htr2c | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled | 8364 | XB-GENE-967634 | Inparanoid, OMA |
| Zebrafish | 100000981 | htr2cl1 | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1 | 7955 | ZDB-GENE-081104-48 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
