Protein or Target Summary

5-hydroxytryptamine receptor 2C

Gene ID	3358
uniprot	P28335
Gene Name	HTR2C
Ensernbl ID	ENSP00000276198
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3358	HTR2C	5-hydroxytryptamine receptor 2C	P28335
MOUSE		Htr2c	Htr2c protein	B2RUD4
MOUSE	15560	Htr2c	Uncharacterized protein	Q8BZI5
MOUSE		Htr2c	5-hydroxytryptamine receptor 2C	B1ATN4
MOUSE		Htr2c	5-hydroxytryptamine receptor 2C	S4R2T0
MOUSE	15560	Htr2c	5-hydroxytryptamine receptor 2C	P34968
RAT	25187	Htr2c	5-hydroxytryptamine (Serotonin) receptor 2C, isoform CRA_b	Q62842
RAT		Htr2c	5-hydroxytryptamine receptor 2C	F1LPS1
RAT		Htr2c	5-hydroxytryptamine receptor 2C	A0A0G2JY06
RAT	25187	Htr2c	5-hydroxytryptamine receptor 2C	P08909

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / 5-hydroxytryptamine receptor 2c

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / 5-hydroxytryptamine receptor / 5-HT2 receptor / 5-hydroxytryptamine receptor 2c

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx