The store will not work correctly when cookies are disabled.
Protein or Target Summary
Adenosine receptor A1
Target ID | 16170 |
Gene ID | 134 |
uniprot | P30542 |
Gene Name | ADORA1 |
Ensernbl ID | ENSP00000356205 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD |
---|
Gene and Protein Information
Protein Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Adenosine receptor / Adenosine receptor a1
Pathway
Data Source | Name | Explore in Pharos | Explore in Source |
---|