The store will not work correctly when cookies are disabled.
ADORA1
Description | Adenosine receptor A1 |
---|
Gene and Protein Information
Gene ID | 134 |
Uniprot Accession IDs | A6NFY5 A6NGP4 A8K1L3 B3KXQ4 D2CGD0 Q6FHK3 Q8TAM8 |
Ensembl ID | ENSP00000356205 |
Symbol | RDC7 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 457638 | ADORA1 | adenosine A1 receptor | 9598 | VGNC:10535 | OMA, EggNOG |
Macaque | 703638 | ADORA1 | adenosine A1 receptor | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 11539 | Adora1 | adenosine A1 receptor | 10090 | MGI:99401 | Inparanoid, OMA, EggNOG |
Rat | 29290 | Adora1 | adenosine A1 receptor | 10116 | RGD:2048 | Inparanoid, OMA, EggNOG |
Dog | 403961 | ADORA1 | adenosine A1 receptor | 9615 | VGNC:37665 | Inparanoid, OMA, EggNOG |
Horse | 100052496 | ADORA1 | adenosine A1 receptor | 9796 | VGNC:15126 | Inparanoid, OMA, EggNOG |
Cow | 282133 | ADORA1 | adenosine A1 receptor | 9913 | VGNC:25686 | Inparanoid, OMA |
Opossum | | ADORA1 | adenosine A1 receptor [Source:HGNC Symbol;Acc:HGNC:262] | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 374212 | ADORA1 | adenosine A1 receptor | 9031 | CGNC:91 | Inparanoid, OMA, EggNOG |
Xenopus | 100127730 | adora1 | adenosine A1 receptor | 8364 | XB-GENE-944026 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|