The store will not work correctly when cookies are disabled.
ORM1
| Description | Alpha-1-acid glycoprotein 1 |
|---|
Gene and Protein Information
| Gene ID | 5004 |
|---|
| Uniprot Accession IDs | B7ZKQ5 Q5T539 Q5U067 Q8TC16 AGP 1 |
|---|
| Ensembl ID | ENSP00000259396 |
|---|
| Symbol | AGP1 ORM AGP1 AGP-A HEL-S-153w |
|---|
| Family | Belongs to the calycin superfamily. Lipocalin family. |
|---|
| Sequence | MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Horse | 100050100 | LOC100050100 | alpha-1-acid glycoprotein 2-like | 9796 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
