The store will not work correctly when cookies are disabled.
Protein or Target Summary
Alpha-1-acid glycoprotein 1
| Gene ID | 5004 |
|---|
| uniprot | P02763 |
|---|
| Gene Name | ORM1 |
|---|
| Ensernbl ID | ENSP00000259396 |
|---|
| Family | Belongs to the calycin superfamily. Lipocalin family. |
|---|
| Sequence | MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5004 | ORM1 | Alpha-1-acid glycoprotein 1 | P02763 |
| MOUSE | | Orm1 | Alpha-1-acid glycoprotein (AGP) | Q61613 |
| MOUSE | | Orm1 | Alpha-1-acid glycoprotein | Q91X23 |
| MOUSE | 18405 | Orm1 | Alpha-1-acid glycoprotein 1 | Q60590 |
| RAT | | Orm1 | Alpha-1-acid glycoprotein | A0A0H2UHF8 |
| RAT | 24614 | Orm1 | Alpha-1-acid glycoprotein | P02764 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
