The store will not work correctly when cookies are disabled.
HLA-A
| Description | HLA class I histocompatibility antigen, A-3 alpha chain |
|---|
Gene and Protein Information
| Gene ID | 3105 |
|---|
| Uniprot Accession IDs | O19546 O19756 Q65A82 Q9GJE6 Q9GJE7 Q9GJE8 Q9MYE6 Q9MYG4 Q9TPR8 |
|---|
| Ensembl ID | ENSP00000379873 |
|---|
| Symbol | HLAA HLAA |
|---|
| Family | Belongs to the MHC class I family. |
|---|
| Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 494187 | PATR-G | MHC class Ib | 9598 | | OMA, EggNOG |
| Macaque | 106995876 | LOC106995876 | HLA class I histocompatibility antigen, A-11 alpha chain-like | 9544 | | OMA, EggNOG |
| Rat | 100364500 | LOC100364500 | RT1 class I, locus CE11-like | 10116 | RGD:2320860 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
