The store will not work correctly when cookies are disabled.
CHMP2B
| Description | Charged multivesicular body protein 2b |
|---|
Gene and Protein Information
| Gene ID | 25978 |
|---|
| Uniprot Accession IDs | B4DJG8 Q53HC7 Q9Y4U6 |
|---|
| Ensembl ID | ENSP00000263780 |
|---|
| Symbol | DMT1 ALS17 VPS2B VPS2-2 CHMP2.5 |
|---|
| Family | Belongs to the SNF7 family. |
|---|
| Sequence | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 735485 | CHMP2B | charged multivesicular body protein 2B | 9598 | VGNC:1776 | OMA, EggNOG |
| Macaque | 719340 | CHMP2B | charged multivesicular body protein 2B | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 68942 | Chmp2b | charged multivesicular body protein 2B | 10090 | MGI:1916192 | Inparanoid, OMA, EggNOG |
| Rat | 363720 | Chmp2b | charged multivesicular body protein 2B | 10116 | RGD:1306781 | Inparanoid, OMA, EggNOG |
| Dog | 487675 | CHMP2B | charged multivesicular body protein 2B | 9615 | VGNC:39223 | Inparanoid, OMA, EggNOG |
| Horse | 100070130 | CHMP2B | charged multivesicular body protein 2B | 9796 | VGNC:16506 | Inparanoid, OMA, EggNOG |
| Cow | 615954 | CHMP2B | charged multivesicular body protein 2B | 9913 | VGNC:27301 | Inparanoid, OMA, EggNOG |
| Pig | 100516044 | CHMP2B | charged multivesicular body protein 2B | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100030296 | CHMP2B | charged multivesicular body protein 2B | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100084750 | CHMP2B | charged multivesicular body protein 2B | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 418461 | CHMP2B | charged multivesicular body protein 2B | 9031 | CGNC:11553 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552916 | chmp2b | charged multivesicular body protein 2B | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 407966 | chmp2b | charged multivesicular body protein 2B | 8364 | XB-GENE-948820 | Inparanoid, OMA, EggNOG |
| Zebrafish | 405840 | chmp2bb | charged multivesicular body protein 2Bb | 7955 | ZDB-GENE-040426-2539 | Inparanoid, OMA |
| C. elegans | 182050 | C01A2.4 | hypothetical protein | 6239 | | Inparanoid, OMA |
| Fruitfly | 38599 | CHMP2B | Charged multivesicular body protein 2b | 7227 | FBgn0035589 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
