HIST1H3A

DescriptionHistone H3.1

Gene and Protein Information

Gene ID8350
Uniprot Accession IDs A0PJT7 A5PLR1 P02295 P02296 P16106 Q6ISV8 Q6NWP8 Q6NWP9 Q6NXU4 Q71DJ3 Q93081
Ensembl ID ENSP00000484841
Symbol H3FA H3/A H3FA
FamilyBelongs to the histone H3 family.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse360198Hist1h3ahistone cluster 1, H3a10090MGI:2668828Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source