The store will not work correctly when cookies are disabled.
Protein or Target Summary
Small ubiquitin-related modifier 1
| Gene ID | 7341 |
|---|
| uniprot | P63165 |
|---|
| Gene Name | SUMO1 |
|---|
| Ensernbl ID | ENSP00000376077 |
|---|
| Family | Belongs to the ubiquitin family. SUMO subfamily. |
|---|
| Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7341 | SUMO1 | Small ubiquitin-related modifier 1 | P63165 |
| MOUSE | 22218 | Sumo1 | Small ubiquitin-related modifier 1 | P63166 |
| MOUSE | | Sumo1 | Small ubiquitin-related modifier 1 | A0A087WRQ4 |
| RAT | 301442 | Sumo1 | Small ubiquitin-related modifier 1 | Q5I0H3 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
