The store will not work correctly when cookies are disabled.
UMPS
| Description | Uridine 5'-monophosphate synthase |
|---|
Gene and Protein Information
| Gene ID | 7372 |
|---|
| Uniprot Accession IDs | B5LY68 B5LY72 O00758 O00759 O00760 Q16862 Q9H3Q2 Q9UG49 UMP synthase |
|---|
| Ensembl ID | ENSP00000232607 |
|---|
| Symbol | OPRT |
|---|
| Family | In the C-terminal section; belongs to the OMP decarboxylase family. |
|---|
| Sequence | MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 460644 | UMPS | uridine monophosphate synthetase | 9598 | VGNC:12223 | OMA, EggNOG |
| Macaque | 715664 | UMPS | uridine monophosphate synthetase | 9544 | | OMA, EggNOG |
| Mouse | 22247 | Umps | uridine monophosphate synthetase | 10090 | MGI:1298388 | OMA, EggNOG |
| Rat | 288051 | Umps | uridine monophosphate synthetase | 10116 | RGD:1311908 | OMA, EggNOG |
| Dog | 478593 | UMPS | uridine monophosphate synthetase | 9615 | VGNC:48132 | OMA, EggNOG |
| Horse | 100070386 | UMPS | uridine monophosphate synthetase | 9796 | VGNC:24788 | OMA, EggNOG |
| Cow | 281568 | UMPS | uridine monophosphate synthetase | 9913 | VGNC:36661 | OMA, EggNOG |
| Opossum | 100020046 | UMPS | uridine monophosphate synthetase | 13616 | | OMA, EggNOG |
| Chicken | 424256 | UMPS | uridine monophosphate synthetase | 9031 | CGNC:8931 | OMA, EggNOG |
| Anole lizard | 100556619 | LOC100556619 | uridine 5'-monophosphate synthase | 28377 | | OMA, EggNOG |
| Xenopus | 496817 | umps | uridine monophosphate synthetase | 8364 | XB-GENE-5874685 | OMA, EggNOG |
| Zebrafish | 393143 | umps | uridine monophosphate synthetase | 7955 | ZDB-GENE-040426-785 | OMA, EggNOG |
| C. elegans | 176453 | umps-1 | Orotidine 5'-phosphate decarboxylase | 6239 | | OMA, EggNOG |
| Fruitfly | 42493 | r-l | rudimentary-like | 7227 | FBgn0003257 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
