JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
TAS2R16

TAS2R16

Description	Taste receptor type 2 member 16

Gene and Protein Information

Gene ID	50833
Uniprot Accession IDs	A4D0X2 Q502V3 Q549U8 Q645W1 T2R16
Ensembl ID	ENSP00000249284
Symbol	BGLPT T2R16
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	494113	TAS2R16	taste 2 receptor member 16	9598	VGNC:8769	Inparanoid, OMA, EggNOG
Mouse	387347	Tas2r118	taste receptor, type 2, member 118	10090	MGI:2681247	Inparanoid, OMA, EggNOG
Rat	78980	Tas2r118	taste receptor, type 2, member 118	10116	RGD:620735	Inparanoid, OMA, EggNOG
Cow	664638	TAS2R16	taste 2 receptor member 16	9913	VGNC:35610	Inparanoid, OMA
Opossum	664658	T2R62	bitter taste receptor Modo-T2R62	13616		Inparanoid, EggNOG

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 16

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]