The store will not work correctly when cookies are disabled.
TAS2R19
| Description | Taste receptor type 2 member 19 |
|---|
Gene and Protein Information
| Gene ID | 259294 |
|---|
| Uniprot Accession IDs | Q3MIJ4 Q645X8 |
|---|
| Ensembl ID | ENSP00000375091 |
|---|
| Symbol | TAS2R23 TAS2R48 T2R19 T2R23 T2R48 MSTP058 TAS2R23 TAS2R48 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATVFNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Dog | 100271744 | CAFA-T2R43 | bitter taste receptor Cafa-T2R43 | 9615 | | Inparanoid, OMA |
| Horse | 100065729 | LOC100065729 | taste receptor type 2 member 50-like | 9796 | | Inparanoid, OMA |
| Cow | 664639 | TAS2R46 | taste receptor, type 2, member 46 | 9913 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
